Heterodimeric antibodies that bind CD3 and CD38

US10526417B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-10526417-B2
Application numberUS-201514952786-A
CountryUS
Kind codeB2
Filing dateNov 25, 2015
Priority dateNov 26, 2014
Publication dateJan 7, 2020
Grant dateJan 7, 2020

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

The present invention is directed to heterodimeric antibodies that bind CD3 and CD38.

First claim

Opening claim text (preview).

What is claimed is: 1. A heterodimeric anti-CD3 and anti-CD38 antibody comprising a) a first monomer comprising: i) a first Fc domain; ii) an anti-CD3 scFv comprising a scFv variable light domain, an scFv linker and a scFv variable heavy domain; wherein said scFv variable light domain comprises a vlCDR1 having SEQ ID NO:15, a vlCDR2 having SEQ ID NO:16 and a vlCDR3 having SEQ ID NO:17, and said scFv variable heavy domain comprises a vhCDR1 having SEQ ID NO:11, a vhCDR2 having SEQ ID NO:12 and a vhCDR3 having SEQ ID NO:13, wherein said scFv is covalently attached to the N-terminus of said Fc domain using a domain linker; b) a second monomer comprising a heavy chain comprising: i) a heavy variable domain; and ii) a heavy constant domain comprising a second Fc domain; and c) a light chain comprising a variable light domain and a constant light domain; wherein said variable light domain comprises a vlCDR1 comprising the sequence RASQNVDTWVA (SEQ ID NO:69), a vlCDR2 comprising the sequence SASYRYS (SEQ ID NO:70) and a vlCDR3 comprising the sequence QQYDSYPLT (SEQ ID NO:71), and said variable heavy domain comprises a vhCDR1 comprising the sequence RSWMN (SEQ ID NO:65), a vhCDR2 comprising the sequence EINPDSSTINYATSVKG (SEQ ID NO:66) and a vhCDR3 comprising the sequence YGNWFPY (SEQ ID NO:67); and wherein said (b)(i) heavy variable domain and said (c) variable light domain bind CD38. 2. The heterodimeric anti-CD3 and anti-CD38 antibody of claim 1 wherein said variable light domain has the sequence DIVMTQSPSSLSASVGDRVTITCRASQNVDTWVAWYQQKPGQSPKALIYSASYRYSGVPD RFTGSGSGTDFTLTISSLQPEDFATYFCQQYDSYPLTFGGGTKLEIK (SEQ ID NO:68) and said variable heavy domain has the sequence EVQLVESGGGLVQPGGSLRLSCAASGFDFSRSWMNWVRQAPGKGLEWVSEINPDSSTIN YATSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYGNWFPYWGQGTLVTVSS (SEQ ID NO:64). 3. The heterodimeric anti-CD3 and anti-CD38 antibody of claim 1 , wherein said scFv linker is a charged linker. 4. The heterodimeric anti-CD3 and anti-CD38 antibody of claim 1 , wherein said scFv has a polypeptide sequence selected from the group consisting of SEQ ID NO:9, SEQ ID NO:45, and SEQ ID NO:54. 5. A nucleic acid composition encoding the heterodimeric antibody of claim 1 , said composition comprising: a) a first nucleic acid encoding said first monomer; b) a second nucleic acid encoding said second monomer; and c) a third nucleic acid encoding said light chain. 6. An expression vector composition comprising: a) an expression vector comprising a nucleic acid encoding a first monomer of claim 1 ; b) an expression vector comprising a nucleic acid encoding said second monomer of claim 1 ; and c) an expression vector comprising a nucleic acid encoding said light chain of claim 1 . 7. A host cell comprising the nucleic acid composition of claim 5 . 8. A host cell comprising the expression vector composition of claim 6 . 9. A method of making a heterodimeric anti-CD3 and anti-CD38 antibody of claim 1 comprising culturing the host cell of claim 7 under conditions wherein said antibody is expressed, and recovering said antibody. 10. A method of making a heterodimeric anti-CD3 and anti-CD38 antibody of claim 1 comprising culturing the host cell of claim 8 under conditions wherein said antibody is expressed, and recovering said antibody. 11. A method of treating cancer comprising administering heterodimeric anti-CD3 and anti-CD38 antibody of claim 1 to a patient in need thereof. 12. The heterodimeric anti-CD3 and anti-CD38 antibody of claim 1 wherein said scFv variable light domain has the sequence SEQ ID NO:14 and said scFv variable heavy domain has the sequence SEQ ID NO:10. 13. The heterodimeric anti-CD3 and anti-CD38 antibody of claim 1 wherein said scFv has the sequence SEQ ID NO:18. 14. A heterodimeric anti-CD3 and anti-CD38 antibody comprising a) a first monomer comprising SEQ ID NO:109; b) a second monomer comprising SEQ ID NO:104; and c) a light chain comprising SEQ ID NO:111. 15. A nucleic acid composition encoding the heterodimeric antibody of claim 1 , said composition comprising: a) a first nucleic acid encoding SEQ ID NO: 109; b) a second nucleic acid encoding SEQ ID NO: 104; and c) a third nucleic acid encoding SEQ ID NO: 111.

Assignees

Inventors

Classifications

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US10526417B2 cover?
The present invention is directed to heterodimeric antibodies that bind CD3 and CD38.
Who is the assignee on this patent?
Xencor Inc
What technology area does this patent fall under?
Primary CPC classification C07K16/18. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue Jan 07 2020 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 7 related publications on this page (citations in our corpus or others sharing the same primary CPC).