Compositions and Conjugates Comprising an Interleukin and Polypeptides That Specifically Bind TGF-beta
US-2018155439-A1 · Jun 7, 2018 · US
Compositions of GM-CSF and interleukin fusions for immune modulation and uses related thereto
US10464982B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-10464982-B2 |
| Application number | US-201515305714-A |
| Country | US |
| Kind code | B2 |
| Filing date | Apr 13, 2015 |
| Priority date | Apr 23, 2014 |
| Publication date | Nov 5, 2019 |
| Grant date | Nov 5, 2019 |
How to read this patent
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
- Title
What the patent document calls the invention.
- Abstract
A short plain-language summary of the technical disclosure.
- Assignees and inventors
Who owns or filed the patent and who is credited as inventor.
- Key dates
Filing, priority, publication, and grant dates set the timeline.
- First independent claim
The legal scope of protection — read this for what is actually claimed.
- CPC / IPC classifications
Technology tags used to group this patent with similar filings.
- Citations and related patents
Prior art links and similar publications in this corpus.
Abstract
Official abstract text for this publication.
This disclosure relates to recombinant proteins comprising a GM-CSF sequence and an interleukin sequence and nucleic acids related thereto. In certain embodiments, the disclosure relates to recombinant proteins comprises N-terminal sequences that are the result of improved production techniques and uses for treating or preventing autoimmune diseases such as multiple sclerosis and cancer.
First claim
Opening claim text (preview).
The invention claimed is: 1. A recombinant protein consisting of GHMAPARS 11 PS 12 PS 13 T 14 QPWEHVNAIQEARRLLN 15 LSRDTAAEMN 16 ETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVGSMRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIOSMHIDATLYTESDVHPSCKVTAMKCFLLELOVISLESGDASIHDTVENLIILANNSLSSNGN 17 VTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS (SEQ ID NO: 12) wherein S 11 , S 12 , S 13 , T 14 , N 15 , N 16 , and N 17 are not conjugated to a glycan. 2. The recombinant protein of claim 1 consisting of SEQ ID NO: 12 made by the process of, expressing a pre-cleavage recombinant protein in a prokaryotic cell, wherein the pre-cleavage recombinant protein comprises a cleavage sequence E-X 18 -X 19 -X 20 -Q-X 21 -H (SEQ ID NO: 13), wherein X 18 , X 19 , and X 20 are independently any amino acid, and X 21 is G, and mixing the pre-cleavage recombinant protein with a tobacco etch virus (TEV) protease under conditions such that a recombinant protein with an N-terminal comprising X 21 -H— is formed. 3. The recombinant protein of claim 2 , wherein the cleavage sequence is ENLYFQGH (SEQ ID NO: 14).
Assignees
Inventors
Classifications
IL-9 · CPC title
Immunosuppressants, e.g. drugs for graft rejection · CPC title
IL-2 · CPC title
Medicinal preparations containing peptides (peptides containing beta-lactam rings A61K31/00; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, A61K31/00; ergot alkaloids of the cyclic peptide type A61K31/48; containing macromolecular compounds having statistically distributed amino acid units A61K31/74; medicinal preparations containing antigens or antibodies A61K39/00; medicinal preparations characterised by the non-active ingredients, e.g. peptides as drug carriers, A61K47/00) · CPC title
- C07K14/535Primary
Granulocyte CSF; Granulocyte-macrophage CSF · CPC title
Patent family
Related publications grouped by family.
External sources
Frequently asked questions
Answers are generated from the same data shown on this page.
- What does patent US10464982B2 cover?
- This disclosure relates to recombinant proteins comprising a GM-CSF sequence and an interleukin sequence and nucleic acids related thereto. In certain embodiments, the disclosure relates to recombinant proteins comprises N-terminal sequences that are the result of improved production techniques and uses for treating or preventing autoimmune diseases such as multiple sclerosis and cancer.
- Who is the assignee on this patent?
- Univ Emory, Childrens Healthcare Atlanta Inc
- What technology area does this patent fall under?
- Primary CPC classification C07K14/535. Mapped technology areas include Chemistry & Metallurgy.
- When was this patent published?
- Publication date Tue Nov 05 2019 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
- What related patents are in patentsdb?
- We list 1 related publication on this page (citations in our corpus or others sharing the same primary CPC).