Peptides including a binding domain of the viral phosphoprotein (P) subunit to the viral RNA free nucleoprotein (N0)

Patent metadata

Field	Value
Publication number	US-10266569-B2
Application number	US-201515325599-A
Country	US
Kind code	B2
Filing date	Jul 17, 2015
Priority date	Jul 18, 2014
Publication date	Apr 23, 2019
Grant date	Apr 23, 2019

Abstract

The invention related to isolated peptides including a binding domain of the viral phosphoprotein (P) subunit to the viral RNA free nucleoprotein (N0) which has the property to inhibit the replication of viruses from the subfamily Paramyxovirinae (like Henipavirus, Rubulavirus or Morbillivirus). These isolated peptides may be used for the prevention or the treatment of Paramyxovirinae infection.

First claim

The invention claimed is:

1. An isolated peptide of at most 100 amino acids comprising an amino acid sequence of formula (I):
Valine-Xaa1-Xaa2-Glycine-Leucine-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8, wherein
Xaa1 is glutamine (Q), serine (S), asparagine (N), lysine (K) or an equivalent polar amino acid;
Xaa2 is glutamic acid (E), aspartic acid (D) asparagine (N), lysine (K), or an equivalent negatively charged, or acid, amino acid;
Xaa3 is glutamic acid (E), aspartic acid (D), lysine (K) or glutamine (Q), serine (S) or asparagine (N);
Xaa4 is cysteine (C) or isoleucine (I);
Xaa5 is isoleucine (I), leucine (L) or valine (V) or an equivalent apolar aliphatic amino acid;
Xaa6 is glutamine (Q), lysine (K), arginine (R) or aspartic acid (D);
Xaa7 is alanine (A), or phenylalanine (F) or an equivalent apolar amino acid; and
Xaa8 is isoleucine (I), leucine (L) or valine (V) or an equivalent apolar aliphatic amino acid.

2. The isolated peptide of claim 1 wherein
Xaa1 is asparagine (N) or glutamine (Q);
Xaa2 is aspartic acid (D) or glutamic acid (E);
Xaa3 is asparagine (N) or glutamic acid (E);
Xaa4 is isoleucine (I) or cysteine (C);
Xaa5 is isoleucine (I);
Xaa6 is aspartic acid (D) or glutamine (Q);
Xaa7 is phenylalanine (F) or alanine (A); and
Xaa8 is isoleucine (I).

3. The isolated peptide according to claim 1 , wherein the peptide is selected from the group consisting of
i) an amino acid sequence ranging from the valine residue at position 7 to the isoleucine residue at position 17 in SEQ ID NO: 1,
ii) an amino acid sequence ranging from the valine residue at position 9 to the leucine residue at position 19 in SEQ ID NO:2, and
iii) an amino acid sequence at least 80% identical to the sequence of (i) or (ii).

4. The isolated peptide according to claim 1 comprising the amino acid sequence of formula (II):
Yaa1-Yaa2-Yaa3-Yaa4-Yaa5-Valine-Xaa1-Xaa2-Glycine-Leucine-Xaa3-Xaa-4-Xaa5-Xaa6-Xaa7-Xaa8-Yaa6-Yaa7-Yaa8, wherein
Xaa1- Xaa2 Xaa3-Xaa4- Xaa5-Xaa6-Xaa7-Xaa8 are as defined in claim 1 ,
Yaa1is aspartic acid (D), glutamic acid (E), or an equivalent acidic amino acid,
Yaa2 is glutamine (Q) or lysine (K),
Yaa3 is alanine (A), leucine (L) or tyrosine (Y),
Yaa4 is glutamic acid (E), tyrosine (Y) or arginine (R),
Yaa5 is asparagine (N), histidine (H) or leucine (L),
Yaa6 is glutamine (Q), lysine (K), or arginine (R),
Yaa7 is lysine (K), alanine (A) or glutamic acid (E), and
Yaa8 is asparagine (N), glutamic acid (E) or serine (S).

5. The isolated peptide of claim 1 , wherein said isolated peptide is linked to at least one cell-penetrating peptide.

6. A pharmaceutical composition comprising a peptide according to claim 1 , and one or more pharmaceutically acceptable excipients.

7. The isolated peptide as defined in claim 1 , wherein said peptide is a modified peptide.

8. The isolated peptide according to claim 3 , wherein the amino acid sequence of (iii) is an amino acid sequence at least 80% identical to the sequence of (i) or (ii).

9. The isolated peptide according to claim 4 , wherein the peptide is selected from the group consisting of
i) the amino acid sequence consisting of MDKLELVNDGLNIIDFIQKNQKEIQKTYGRSSIQQPSIKD (SEQ ID NO: 1);
ii) an amino acid sequence ranging from the leucine residue at position 6 to the aspartic acid residue at position 40 in SEQ ID NO:1;
iii) an amino acid sequence ranging from the leucine residue at position 11 to the aspartic acid residue at position 40 in SEQ ID NO:1;
iv) an amino acid sequence ranging from the methionine residue at position 1 to the asparagine residue at position 20 in SEQ ID NO:1;
v) an amino acid sequence ranging from asparagine residue at position 20 to the glutamine residue at position 35 in SEQ ID NO:1;
vi) the amino acid sequence consisting of MAEEQAYHVSKGLECLKALRENPPDIEEIQEVSSLRDQTC (SEQ ID NO: 2);
vii) an amino acid sequence ranging from the methionine residue at position 1to the asparagine residue at position 22 in SEQ ID NO:2;
viii) the amino acid sequence consisting of DQAENVQEGLECIQAIQKN (SEQ ID NO: 3);
ix) the amino acids sequence consisting of MAEEQARHVKNGLECIRALKAEPIGSLAIEEAMAAWSEIS (SEQ ID NO: 4);
x) an amino acid sequence ranging from the valine residue at position 9 to the leucine residue at position 19 in SEQ ID NO:4; and
xi) an amino acid sequence at least 80% identical to the sequence of one of (i) to (x).

10. The isolated peptide according to claim 9 , wherein the amino acid sequence of (xi) is an amino acid sequence at least 80% identical to the sequence of one of (i) to (x).

11. A method for producing a peptide as defined in claim 1 , wherein said method comprises the steps of:
a) culturing a recombinant cell comprising a recombinant vector comprising a polynucleotide comprising of a nucleic acid encoding a peptide as defined in claim 1 in conditions allowing the expression of the peptide;
b) optionally, purifying the peptide obtained at step a).

12. The method of claim 11 , wherein the polynucleotide consists of the nucleic acid encoding the peptide as defined in claim 1 .

13. A method for treating a Paramyxovirinae infection comprising a step of administering at least one isolated peptide as defined in claim 1 , wherein said Paramyxovirinae infection is selected from the group consisting of Rubulavirus infection, Avulavirus infection, Henipavirus infection, Henipavirus-like infection, Morbillivirus infection, Morbillivirus-like (TPMV-like viruses) infection, Respirovirus infection and Ferlavirus infection.

14. The method for treating a Paramyxovirinae infection as defined in claim 13 , wherein
said Avulavirus infection is an infection with the Newcastle disease virus;
said Henipavirus infection is an infection with the Nipah virus (NiV) or with the Hendra virus (HeV);
said Morbillivirus infection is an infection with the Measles virus (MeV), the Rinderpest virus, the Canine distemper virus, the phocine distemper virus or the Ovine rinderpest virus;
said TPMV-like virus infection is an infection with the Tupaia paramyxovirus, the Mossman virus, the Nariva virus or the Salem virus;
said Ferlavirus infection is an infection with the Fer-de-Lance virus;
said Rubulavirus infection is an infection with the Mumps virus, the parainfluenza type 2, 4 viruses, the Achimota virus 1 and2, the Simian parainfluenza virus 5, the Menangle virus, the Tioman virus, or the Tuhokovirus 1, 2 and 3; and
said Respirovirus infection is an infection with the Sendai virus or the human parainfluenza viruses 1 and 3.

15. The method as defined in claim 13 , wherein said isolated peptide is linked to at least one cell-penetrating peptide.

16. The method as defined in claim 13 , wherein said isolated peptide is a modified peptide.

Assignees

• Inst Nat Sante Rech Med
• Centre Nat Rech Scient
• Univ Claude Bernard—Lyon 1
• Ecole Normale Superieure De Lyon Ens De Lyon
• Univ Grenoble Alpes
• Centre National De Le Recherche Scient Cnrs
• Univ Grenobles Alpes

Inventors

• Volchkov Viktor
• Jamin Marc
• Lawrence Philip
• Yabukarski Filip

Classifications

• A61P31/14

  for RNA viruses · CPC title

• C12N2760/18433

  Use of viral protein as therapeutic agent other than vaccine, e.g. apoptosis inducing or anti-inflammatory · CPC title

• C12N2760/18233

  Use of viral protein as therapeutic agent other than vaccine, e.g. apoptosis inducing or anti-inflammatory · CPC title

• A61K38/00

  Medicinal preparations containing peptides (peptides containing beta-lactam rings A61K31/00; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, A61K31/00; ergot alkaloids of the cyclic peptide type A61K31/48; containing macromolecular compounds having statistically distributed amino acid units A61K31/74; medicinal preparations containing antigens or antibodies A61K39/00; medicinal preparations characterised by the non-active ingredients, e.g. peptides as drug carriers, A61K47/00) · CPC title

• C12N2760/18222

  New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes · CPC title