Compositions and methods for immunooncology
US-2024417722-A1 · Dec 19, 2024 · US
US10167330B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-10167330-B2 |
| Application number | US-201515308535-A |
| Country | US |
| Kind code | B2 |
| Filing date | Apr 30, 2015 |
| Priority date | May 2, 2014 |
| Publication date | Jan 1, 2019 |
| Grant date | Jan 1, 2019 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
This disclosure relates to variable lymphocyte receptors (VLRs) modifications such as humanized sequences and polypeptides comprising such sequences that specifically bind a target molecule and uses related thereto. In certain embodiments, the disclosure relates to recombinant polypeptide VLRs disclosed herein and variants thereof. In certain embodiments, this disclosure relates to treating or preventing a disease or condition comprising administering an effective amount of a recombinant polypeptide or variant disclosed herein to a subject in need thereof.
Opening claim text (preview).
What we claim: 1. A recombinant polypeptide comprising an amino acid sequence XLXLXXNKLQTIAKGTFSPLRAIQXMXLXX (SEQ ID NO: 38) wherein X at each position is individually and independently any amino acid provided that the polypeptide does not contain at least one of the following wild-type Slit2-D2 sequences selected from LLSLYD (SEQ ID NO: 16), and TMHLAQ (SEQ ID NO: 17). 2. The recombinant polypeptide of claim 1 further comprising a human Fc sequence. 3. The recombinant polypeptide of claim 1 comprising an amino acid sequence DLHNLNY L D L NN NKLQTIAKGTFSPLRAIQ H M W L YQNPFICDC (SEQ ID NO: 71). 4. The recombinant polypeptide of claim 1 comprising an amino acid sequence CPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNN QISELAPDAFQGLRSLNSLDLGGNKITELPKSLFEGLFSLQLLLLNANKINXLRVDAFQDL HNLNLLSLDDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLSIAMRWDGK AVNDPDSARCTSPRRLANKRIGQIKSKKFRC (SEQ ID NO: 24). 5. The recombinant polypeptide of claim 1 comprising an amino acid sequence CPAACTCSNNTVDCRSKGLTEIPTNLPETITIIYLHDNTIKVIPPGAFSPYKKLREIYLGSNQ ISELAPDAFQGLRSLNVLDLGTNKITELPKSLFEGLFSLQELFLCCNKINCLRVDAFQDLH NLNHLALDQNKLQTIAKGTFSPLRAIQHMYLFGNPFICDCHLKWLADYLHIAMIMDGK AVNDPDSARCTSPRRLANKRIGQIKSKKFRC (SEQ ID NO: 1). 6. The recombinant polypeptide of claim 1 , wherein an X is the amino acid tyrosine. 7. The recombinant polypeptide of claim 1 , wherein an X is the amino acid selected from phenylalanine (Phe), tryptophan (Trp) and histidine (His). 8. The recombinant polypeptide of claim 1 , wherein an X is the amino acid selected from asparagine (Asn) and aspartic acid (Asp).
T-cell receptor (TcR)-CD3 complex · CPC title
Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto · CPC title
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor (mutants or genetically engineered microorganisms, per se C12N1/00, C12N5/00, C12N7/00; new plants per se A01H; plant reproduction by tissue culture techniques A01H4/00; new animals per se A01K67/00; use of medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases, gene therapy A61K48/00) · CPC title
from fish · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.