Modified recombinant variable lymphocyte receptors (VLR)

US10167330B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-10167330-B2
Application numberUS-201515308535-A
CountryUS
Kind codeB2
Filing dateApr 30, 2015
Priority dateMay 2, 2014
Publication dateJan 1, 2019
Grant dateJan 1, 2019

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

This disclosure relates to variable lymphocyte receptors (VLRs) modifications such as humanized sequences and polypeptides comprising such sequences that specifically bind a target molecule and uses related thereto. In certain embodiments, the disclosure relates to recombinant polypeptide VLRs disclosed herein and variants thereof. In certain embodiments, this disclosure relates to treating or preventing a disease or condition comprising administering an effective amount of a recombinant polypeptide or variant disclosed herein to a subject in need thereof.

First claim

Opening claim text (preview).

What we claim: 1. A recombinant polypeptide comprising an amino acid sequence XLXLXXNKLQTIAKGTFSPLRAIQXMXLXX (SEQ ID NO: 38) wherein X at each position is individually and independently any amino acid provided that the polypeptide does not contain at least one of the following wild-type Slit2-D2 sequences selected from LLSLYD (SEQ ID NO: 16), and TMHLAQ (SEQ ID NO: 17). 2. The recombinant polypeptide of claim 1 further comprising a human Fc sequence. 3. The recombinant polypeptide of claim 1 comprising an amino acid sequence DLHNLNY L D L NN NKLQTIAKGTFSPLRAIQ H M W L YQNPFICDC (SEQ ID NO: 71). 4. The recombinant polypeptide of claim 1 comprising an amino acid sequence CPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNN QISELAPDAFQGLRSLNSLDLGGNKITELPKSLFEGLFSLQLLLLNANKINXLRVDAFQDL HNLNLLSLDDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLSIAMRWDGK AVNDPDSARCTSPRRLANKRIGQIKSKKFRC (SEQ ID NO: 24). 5. The recombinant polypeptide of claim 1 comprising an amino acid sequence CPAACTCSNNTVDCRSKGLTEIPTNLPETITIIYLHDNTIKVIPPGAFSPYKKLREIYLGSNQ ISELAPDAFQGLRSLNVLDLGTNKITELPKSLFEGLFSLQELFLCCNKINCLRVDAFQDLH NLNHLALDQNKLQTIAKGTFSPLRAIQHMYLFGNPFICDCHLKWLADYLHIAMIMDGK AVNDPDSARCTSPRRLANKRIGQIKSKKFRC (SEQ ID NO: 1). 6. The recombinant polypeptide of claim 1 , wherein an X is the amino acid tyrosine. 7. The recombinant polypeptide of claim 1 , wherein an X is the amino acid selected from phenylalanine (Phe), tryptophan (Trp) and histidine (His). 8. The recombinant polypeptide of claim 1 , wherein an X is the amino acid selected from asparagine (Asn) and aspartic acid (Asp).

Assignees

Inventors

Classifications

  • T-cell receptor (TcR)-CD3 complex · CPC title

  • Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto · CPC title

  • Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor (mutants or genetically engineered microorganisms, per se C12N1/00, C12N5/00, C12N7/00; new plants per se A01H; plant reproduction by tissue culture techniques A01H4/00; new animals per se A01K67/00; use of medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases, gene therapy A61K48/00) · CPC title

  • from fish · CPC title

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US10167330B2 cover?
This disclosure relates to variable lymphocyte receptors (VLRs) modifications such as humanized sequences and polypeptides comprising such sequences that specifically bind a target molecule and uses related thereto. In certain embodiments, the disclosure relates to recombinant polypeptide VLRs disclosed herein and variants thereof. In certain embodiments, this disclosure relates to treating or …
Who is the assignee on this patent?
Univ Emory
What technology area does this patent fall under?
Primary CPC classification C07K14/7051. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue Jan 01 2019 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).