Anti-ricin antibodies and uses thereof

Patent metadata

Field	Value
Publication number	US-10081672-B2
Application number	US-201615088944-A
Country	US
Kind code	B2
Filing date	Apr 1, 2016
Priority date	Jun 10, 2011
Publication date	Sep 25, 2018
Grant date	Sep 25, 2018

Abstract

The present invention relates to anti-ricin antibodies and uses thereof. More specifically, the invention relates to anti-ricin antibodies and fragments thereof as well as their use in therapy or prophylaxis.

First claim

The invention claimed is:

1. A method of preventing deleterious effects caused by ricin exposure or of treating exposure to ricin, comprising administering
an antibody or fragment thereof, or
a composition comprising an antibody or fragment thereof and a pharmaceutically acceptable diluent, excipient, or carrier

to a subject in need thereof, wherein the antibody or fragment thereof comprises a CDR L1 of sequence KASQDVTAAVA (SEQ ID NO:4), a CDR L2 of sequence SASYRYT (SEQ ID NO:8), and a CDR L3 of sequence QQYYNTPLT (SEQ ID NO:12); and a variable heavy chain comprising CDR H1 of sequence EHIIN (SEQ ID NO:16), a CDR H2 of sequence LINPNSGGTNYNQKFKD (SEQ ID NO:20), and a CDR H3 of sequence LRYDAAY (SEQ ID NO:24), and wherein the antibody or fragment thereof specifically binds ricin toxin lectin-B protein.

2. The method of claim 1 , wherein the subject is a mouse or a human.

3. The method of claim 1 , wherein the antibody or fragment thereof comprises
the variable light chain sequence:

(SEQ ID NO: 31)

DIELTQSHKFMSTSVGDRVSITCKASQDVTAAVAWYQQKPGQSPKLLIHS

ASYRYTGVPDRFTGSGSGSDFTFTISSVQAEDLAVYYCQQYYNTPLTFGA

GTKLELKR

or a sequence at least 95% identical thereto:
and the variable heavy chain sequence:

(SEQ ID NO: 32)

QVQLQESGPELVKPGASMKISCKASGYSFTEHIINWVKQTHRENLEWIGL

INPNSGGTNYNQKFKDKATLTVDTASNTAYMELLSLTSEDSAVYYCARLR

YDAAYWGQGTTVTVSS,

or a sequence at least 95% identical thereto.

4. The method of claim 1 , wherein the antibody or fragment thereof of claim 1 , is an IgG.

5. The method of claim 1 , wherein the one or more than one antibody or fragment thereof is administered to the subject several hours following exposure to the ricin toxin to treat ricin exposure.

6. The method of claim 1 , wherein the one or more than one antibody or fragment thereof is administered to the subject several weeks prior to exposure to the ricin toxin to protect the subject against ricin exposure.

7. The method of claim 1 , further comprising administering a second antibody or fragment thereof said second antibody or fragment thereof comprising the variable light chain sequence:

(SEQ ID NO: 27)

DIVLTQSPSSMYASLGERVTITCKASQDINNYLRWFQQKPGKSPKTLIYR

ANRLVDGVPSRFSGSGSGQDYSLTISSLEYEDMGFYSCLQYDEFPYTFGG

GTKLEIKR

or a sequence at least 95% identical thereto;
and the variable heavy chain sequence:

(SEQ ID NO: 23)

QVQLQESGPELVKPGASMKISCKASGYSFTEHIINWVKQTHRENLEWIGL

INPNSGGTNYNQKFKDKATLTVDTASNTAYMELLSLTSEDSAVYYCARLR

YDAAYWGQGTTVTVSS,

or a sequence at least 95% identical thereto.

8. The method of claim 7 , wherein at least one of the antibodies or fragments thereof is humanized.

9. The method of any one of claim 1 - 4 , wherein preventing deleterious effects caused by ricin exposure is achieved by conferring immunity against ricin by administering the antibody or fragment thereof prior to exposure.

10. The method of claim 9 , wherein administering the antibody or fragment thereof occurs at least 1 day prior to exposure.

Assignees

• Canada Minister Nat Defence
• Nat Res Council Canada

Inventors

• Hu Wei-Gang
• Negrych Laurel M
• Chau Damon
• Yin Junfei
• Jager Scott J
• Cherwonogrodzky John W

Classifications

• A61K2039/505

  comprising antibodies · CPC title

• C07K16/16 Primary

  against material from plants · CPC title

• A61P39/02

  Antidotes · CPC title

• C07K2317/56

  variable (Fv) region, i.e. VH and/or VL · CPC title

• C07K2317/92

  Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value · CPC title