Gene sequence construct for gene therapy of human immunodeficiency virus infection
US-2024352096-A1 · Oct 24, 2024 · US
Therapy for filovirus infection
US10081669B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-10081669-B2 |
| Application number | US-201615161634-A |
| Country | US |
| Kind code | B2 |
| Filing date | May 23, 2016 |
| Priority date | Jun 3, 2013 |
| Publication date | Sep 25, 2018 |
| Grant date | Sep 25, 2018 |
How to read this patent
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
- Title
What the patent document calls the invention.
- Abstract
A short plain-language summary of the technical disclosure.
- Assignees and inventors
Who owns or filed the patent and who is credited as inventor.
- Key dates
Filing, priority, publication, and grant dates set the timeline.
- First independent claim
The legal scope of protection — read this for what is actually claimed.
- CPC / IPC classifications
Technology tags used to group this patent with similar filings.
- Citations and related patents
Prior art links and similar publications in this corpus.
Abstract
Official abstract text for this publication.
The present invention addresses a need for improved treatments for Filovirus infections.
First claim
Opening claim text (preview).
What is claimed: 1. An isolated humanized anti-Filovirus glycoprotein pre-fusion core antibody comprising a framework region having a sequence of 95% or greater identity to a human antibody framework region, and comprising (a) a heavy chain CDR1 comprising GFAFNYYDMH (SEQ ID NO:1); a heavy chain CDR2 comprising YINPGGGNTYYADSV (SEQ ID NO:2); and a heavy chain CDR3 comprising QLYGNSFMDY (SEQ ID NO:3), and (b) a light chain sequence DIQMTQSPSSLSASVGDRVTITCQASQDVTTAVAWYQQKPGKAPKL (SEQ ID NO:12) comprising a light chain CDR1, a light chain sequence LIYAASGRHKGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQ (SEQ ID NO:13) comprising a light chain CDR2, and a light chain CDR3 comprising HYSTPLT (SEQ ID NO:5). 2. The humanized antibody of claim 1 , wherein the heavy chain comprises the sequence EVQLVESGGGLVQPGGSLRLSCAASGFAFNYYDMHWVRQAPGKGLE (SEQ ID NO:8). 3. The humanized antibody of claim 1 , wherein the heavy chain comprises the sequence WVAYINPGGGNTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTA (SEQ ID NO:9). 4. The humanized antibody of claim 1 , wherein the heavy chain comprises the sequence VYYCARQLYGNSFMDYWGQGTLVTV (SEQ ID NO:10). 5. The humanized antibody of claim 1 , wherein the light chain comprises the sequence HYSTPLTFGQGTKVFI (SEQ ID NO:16). 6. An antigen-binding fragment of the antibody of claim 1 . 7. A composition comprising the antibody of claim 1 or an antigen-binding fragment thereof. 8. The composition of claim 7 , comprising a pharmaceutically acceptably carrier. 9. A method of inhibiting an Ebola virus infection of a subject comprising administering to the subject an amount of the antibody of claim 1 or an antigen-binding fragment thereof effective to inhibit an Ebola virus infection in a subject, wherein administration is prior to the subject being exposed to the Ebola virus, further wherein the Ebola virus is the Sudan strain.
Assignees
Inventors
Classifications
- C07K16/10Primary
RNA viruses · CPC title
Complementarity determining region [CDR] · CPC title
Framework region [FR] · CPC title
containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered · CPC title
comprising antibodies · CPC title
Patent family
Related publications grouped by family.
External sources
Frequently asked questions
Answers are generated from the same data shown on this page.
- What does patent US10081669B2 cover?
- The present invention addresses a need for improved treatments for Filovirus infections.
- Who is the assignee on this patent?
- Albert Einstein College Medicine Inc, Governing Council Univ Toronto, Us Army
- What technology area does this patent fall under?
- Primary CPC classification C07K16/10. Mapped technology areas include Chemistry & Metallurgy.
- When was this patent published?
- Publication date Tue Sep 25 2018 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
- What related patents are in patentsdb?
- We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).