Methods and nucleic acid molecules for aav vector selection
US-2024417717-A1 · Dec 19, 2024 · US
US10053493B2 · US · B2
| Field | Value |
|---|---|
| Publication number | US-10053493-B2 |
| Application number | US-201414392127-A |
| Country | US |
| Kind code | B2 |
| Filing date | Jun 26, 2014 |
| Priority date | Jun 26, 2013 |
| Publication date | Aug 21, 2018 |
| Grant date | Aug 21, 2018 |
A practical reading order for non-experts. Skip the full description unless you need deep technical detail.
What the patent document calls the invention.
A short plain-language summary of the technical disclosure.
Who owns or filed the patent and who is credited as inventor.
Filing, priority, publication, and grant dates set the timeline.
The legal scope of protection — read this for what is actually claimed.
Technology tags used to group this patent with similar filings.
Prior art links and similar publications in this corpus.
Official abstract text for this publication.
The present invention provides compositions and methods of use comprising a chimeric dengue virus E glycoprotein comprising a dengue virus E glycoprotein backbone, which comprises amino acid substitutions that introduce an epitope that is recognized by an antibody from a dengue virus serotype that is different from the dengue virus serotype of the dengue virus E glycoprotein backbone.
Opening claim text (preview).
What is claimed is: 1. A chimeric dengue virus E glycoprotein, comprising the amino acid sequence: (SEQ ID NO: 3) MRCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKDKPTLDIELLKTEA TQLATLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDTNFVCRRTFVDRG WGNGCGLFGKGSLITCAKFKCVTK I EGK V VQYENLKYSVIVTVHTGDQHQ VGNETTEHGT I ATITPQAPTSEIQLTDYGALTLDCSPRTGLDFNEM I LLT M KN K A W M VHRQWFLDLPLPWTSGASTSQETWNRQDLLVTFKTAHAKKQEV VVLGSQEGAMHTALTGATEIQ N SG G T S IFAGHLKCRLKMKLTLKGMSYVM CTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRL ITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKG. 2. A chimeric dengue virus E glycoprotein, comprising the amino acid sequence: (SEQ ID NO: 4) MRCVGIGNRDFVEGLSGATWVDVVLEHGGCVTTMAKNKPTLDIEL F KTE V T NP AVLRKLCIEGKITNITTDSRCPTQGEAVLPEEQDQNYVCKHTYVDRG WGNGCGLFGKGSLVTCAKFQCLEPIEGKVVQYENLKY S VI V TVHTGDQHQ VGNET TEH G TI A T ITPQA P TSE IQ LT D YG A LGLECSPRTGLDFNEMILLT MKNKAWMVHRQWFFDLPLPWTSGATTETPTWNRKELLVTFKNAHAKKQEV VVLGSQEGAMHTALTGATEIQ T SG T T T IFAGHLKCRLKMDKLELKGMSYA MCTNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGR LITANPVVTKKEEPVNIEAEPPFGESNIVIGIGDNALKINWYKKG. 3. A flavivirus particle or virus like particle (VLP) comprising the E glycoprotein of claim 1 . 4. A composition comprising the E glycoprotein of claim 1 in a pharmaceutically acceptable carrier. 5. A method of producing an immune response to a dengue virus in a subject, comprising administering to the subject an effective amount of the E glycoprotein of claim 1 . 6. A flavivirus particle or virus like particle (VLP) comprising the E glycoprotein of claim 2 . 7. A composition comprising the E glycoprotein of claim 2 in a pharmaceutically acceptable carrier. 8. A method of producing an immune response to a dengue virus in a subject, comprising administering to the subject an effective amount of the E glycoprotein of claim 2 .
Immunomodulators · CPC title
for RNA viruses · CPC title
Antivirals · CPC title
Antibacterial agents · CPC title
Togaviridae (F); Matonaviridae (F); Flaviviridae (F) · CPC title
Related publications grouped by family.
Answers are generated from the same data shown on this page.