Methods and compositions for dengue virus vaccines

US10053493B2 · US · B2

Patent metadata
FieldValue
Publication numberUS-10053493-B2
Application numberUS-201414392127-A
CountryUS
Kind codeB2
Filing dateJun 26, 2014
Priority dateJun 26, 2013
Publication dateAug 21, 2018
Grant dateAug 21, 2018

How to read this patent

A practical reading order for non-experts. Skip the full description unless you need deep technical detail.

  1. Title

    What the patent document calls the invention.

  2. Abstract

    A short plain-language summary of the technical disclosure.

  3. Assignees and inventors

    Who owns or filed the patent and who is credited as inventor.

  4. Key dates

    Filing, priority, publication, and grant dates set the timeline.

  5. First independent claim

    The legal scope of protection — read this for what is actually claimed.

  6. CPC / IPC classifications

    Technology tags used to group this patent with similar filings.

  7. Citations and related patents

    Prior art links and similar publications in this corpus.

Abstract

Official abstract text for this publication.

The present invention provides compositions and methods of use comprising a chimeric dengue virus E glycoprotein comprising a dengue virus E glycoprotein backbone, which comprises amino acid substitutions that introduce an epitope that is recognized by an antibody from a dengue virus serotype that is different from the dengue virus serotype of the dengue virus E glycoprotein backbone.

First claim

Opening claim text (preview).

What is claimed is: 1. A chimeric dengue virus E glycoprotein, comprising the amino acid sequence: (SEQ ID NO: 3) MRCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKDKPTLDIELLKTEA TQLATLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDTNFVCRRTFVDRG WGNGCGLFGKGSLITCAKFKCVTK I EGK V VQYENLKYSVIVTVHTGDQHQ VGNETTEHGT I ATITPQAPTSEIQLTDYGALTLDCSPRTGLDFNEM I LLT M KN K A W M VHRQWFLDLPLPWTSGASTSQETWNRQDLLVTFKTAHAKKQEV VVLGSQEGAMHTALTGATEIQ N SG G T S IFAGHLKCRLKMKLTLKGMSYVM CTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRL ITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKG. 2. A chimeric dengue virus E glycoprotein, comprising the amino acid sequence: (SEQ ID NO: 4) MRCVGIGNRDFVEGLSGATWVDVVLEHGGCVTTMAKNKPTLDIEL F KTE V T NP AVLRKLCIEGKITNITTDSRCPTQGEAVLPEEQDQNYVCKHTYVDRG WGNGCGLFGKGSLVTCAKFQCLEPIEGKVVQYENLKY S VI V TVHTGDQHQ VGNET TEH G TI A T ITPQA P TSE IQ LT D YG A LGLECSPRTGLDFNEMILLT MKNKAWMVHRQWFFDLPLPWTSGATTETPTWNRKELLVTFKNAHAKKQEV VVLGSQEGAMHTALTGATEIQ T SG T T T IFAGHLKCRLKMDKLELKGMSYA MCTNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGR LITANPVVTKKEEPVNIEAEPPFGESNIVIGIGDNALKINWYKKG. 3. A flavivirus particle or virus like particle (VLP) comprising the E glycoprotein of claim 1 . 4. A composition comprising the E glycoprotein of claim 1 in a pharmaceutically acceptable carrier. 5. A method of producing an immune response to a dengue virus in a subject, comprising administering to the subject an effective amount of the E glycoprotein of claim 1 . 6. A flavivirus particle or virus like particle (VLP) comprising the E glycoprotein of claim 2 . 7. A composition comprising the E glycoprotein of claim 2 in a pharmaceutically acceptable carrier. 8. A method of producing an immune response to a dengue virus in a subject, comprising administering to the subject an effective amount of the E glycoprotein of claim 2 .

Assignees

Inventors

Classifications

Patent family

Related publications grouped by family.

External sources

Frequently asked questions

Answers are generated from the same data shown on this page.

What does patent US10053493B2 cover?
The present invention provides compositions and methods of use comprising a chimeric dengue virus E glycoprotein comprising a dengue virus E glycoprotein backbone, which comprises amino acid substitutions that introduce an epitope that is recognized by an antibody from a dengue virus serotype that is different from the dengue virus serotype of the dengue virus E glycoprotein backbone.
Who is the assignee on this patent?
Univ North Carolina Chapel Hill
What technology area does this patent fall under?
Primary CPC classification C07K14/005. Mapped technology areas include Chemistry & Metallurgy.
When was this patent published?
Publication date Tue Aug 21 2018 00:00:00 GMT+0000 (Coordinated Universal Time) (B2). Legal status and post-grant events are not shown on this page.
What related patents are in patentsdb?
We list 8 related publications on this page (citations in our corpus or others sharing the same primary CPC).